DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Try29F

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:223 Identity:91/223 - (40%)
Similarity:126/223 - (56%) Gaps:10/223 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLS-VRVGSSFTFFG 86
            |||||.:..|..:|:|.|:.|...| ||.::.::..|:||||| |:.....|| ||:|||.|..|
  Fly    41 RIVGGQVANIKDIPYQVSLQRSYHF-CGGSLIAQGWVLTAAHC-TEGSAILLSKVRIGSSRTSVG 103

  Fly    87 GQVVRVSSVLLHEEYD-QSWSNDIAVMRLQ--SKLRLGSAVSVIPLADTPPASGSPATVSGWGAI 148
            ||:|.:..|..|.::| .:...|.:::.|:  |...:..|...:|..|...|.|:|..|||||..
  Fly   104 GQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNT 168

  Fly   149 GFKKNYPMSILSASVDIVDQDQCRRSYGR--KITKDMICAAAP--GKDACSGDSGGPLVSGNKLV 209
            ...:.....:.|.:|..|.|.||..:||.  .||..|:||..|  |||||.|||||||.:...|.
  Fly   169 QSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLW 233

  Fly   210 GIVSFGKECAHPEYPGVYANVAELKPWI 237
            |:||:|..||.|.|||||:.|:.::.||
  Fly   234 GVVSWGYGCARPNYPGVYSRVSAVRDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 89/221 (40%)
Tryp_SPc 24..237 CDD:238113 88/220 (40%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 89/221 (40%)
Tryp_SPc 42..264 CDD:238113 90/222 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443397
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.