DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and PRSS38

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:240 Identity:76/240 - (31%)
Similarity:120/240 - (50%) Gaps:25/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHC--------LTDRETEFLSVRVG 79
            :|:||........|||.|:...|...||.:|.:|..|::||||        :.|.....:::||.
Human    59 KILGGVPAPERKWPWQVSVHYAGLHVCGGSILNEYWVLSAAHCFHRDKNIKIYDMYVGLVNLRVA 123

  Fly    80 SSFTFFGGQVVRVSSVLLHEEYD--QSWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPAT- 141
            .:.|    |...|:.|:||..|:  .....|:|:::|::::....:|..:.|| ||..:.:.|. 
Human   124 GNHT----QWYEVNRVILHPTYEMYHPIGGDVALVQLKTRIVFSESVLPVCLA-TPEVNLTSANC 183

  Fly   142 -VSGWGAIGFKKNYPMSILSASVDIVDQDQCRRSYGRK--ITKDMICAA--APGKDACSGDSGGP 201
             .:|||.:..:......:....:.::.:..|...||..  |..||:||.  ...|..|.||||||
Human   184 WATGWGLVSKQGETSDELQEMQLPLILEPWCHLLYGHMSYIMPDMLCAGDILNAKTVCEGDSGGP 248

  Fly   202 LV-SGNK---LVGIVSFGKECAHPEYPGVYANVAELKPWILGAIE 242
            || ..|:   .:||||:|:.|::|.||||||:|:....||...||
Human   249 LVCEFNRSWLQIGIVSWGRGCSNPLYPGVYASVSYFSKWICDNIE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 72/233 (31%)
Tryp_SPc 24..237 CDD:238113 72/232 (31%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 74/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.