DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and CG4271

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:247 Identity:76/247 - (30%)
Similarity:128/247 - (51%) Gaps:14/247 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIFLAFSVTVVSSNWIPERIVGG-DLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTD 68
            |:.:.|:   .|||.|...:... |..|.|:..|.:     |...||.|:....||:|||.|:.:
  Fly     7 WVLILFA---RSSNGIYNGVEAKFDFWTFLASVWVS-----GYHECGGAVIDSRIVLTAAQCVKN 63

  Fly    69 RETEFLSVRVGSSFTFFGGQVVRVSSVLLHEEYDQSWSNDIAVMRLQSKLRLGSAVSVIPLADTP 133
            :..:.::||||:...:.||:::||:::::||.| ::|.||||::.|:..: |...|:.||||...
  Fly    64 KPVKRITVRVGTPDIYRGGRIIRVTALVVHENY-KNWDNDIALLWLEKPV-LSVRVTKIPLATKE 126

  Fly   134 PASGSPATVSGWGAIGFKKNYPMS--ILSASVDIVDQDQCRRSYGRKITKDMICAAAPGKDACSG 196
            |:.....:.:|||. ...::|.::  :.:....|..:..|.......:.::::||.....|.|.|
  Fly   127 PSENEYPSNAGWGE-KLLESYVVTRKLQNGVTKIRPRSMCAEELVEPVGEELLCAFYTENDICPG 190

  Fly   197 DSGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWILGAIERITKSE 248
            |.|||||..||:|||...|..|.....|.:|.||.....||....|::.|::
  Fly   191 DYGGPLVLANKVVGIAVQGHGCGFAVLPSLYTNVFHYLEWIEENAEKLIKNK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 66/216 (31%)
Tryp_SPc 24..237 CDD:238113 66/215 (31%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 69/222 (31%)
Tryp_SPc 19..231 CDD:214473 67/219 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.