DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and CG1304

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:226 Identity:75/226 - (33%)
Similarity:120/226 - (53%) Gaps:14/226 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRET---------EFLSVRV 78
            |:|||:.......|.|.|:...|...||.:|.|.:.|:|||||:|::::         |..::|.
  Fly    31 RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRA 95

  Fly    79 GSSFTFFGGQVVRVSSVLLHEEYDQSWSNDIAVMRLQSKLRLGSAVSVI--PLADTPPASGSPAT 141
            ||:..|.||.:|:|:.|::||||. ::.||:|::||:|.|.|.:::..|  |.||||  :.....
  Fly    96 GSNDRFSGGVLVQVAEVIVHEEYG-NFLNDVALLRLESPLILSASIQPIDLPTADTP--ADVDVI 157

  Fly   142 VSGWGAIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAAAPGKDACSGDSGGPLVSGN 206
            :||||.|..:.:.|..:...::..:..::|....|..:..::.........||:||||||.|..|
  Fly   158 ISGWGRIKHQGDLPRYLQYNTLKSISLERCDELIGWGVQSELCLIHEADNGACNGDSGGPAVYNN 222

  Fly   207 KLVGIVSFGKECAHPEYPGVYANVAELKPWI 237
            ::||:..|........||..||.|.....||
  Fly   223 QVVGVAGFVWSACGTSYPDGYARVYYHNEWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 73/224 (33%)
Tryp_SPc 24..237 CDD:238113 72/223 (32%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 73/224 (33%)
Tryp_SPc 32..256 CDD:238113 74/225 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.