DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Prss53

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:221 Identity:67/221 - (30%)
Similarity:99/221 - (44%) Gaps:32/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRET-EFLSVRVGSSFTFFGGQVVRVSSVLLHE 99
            ||.|.:...|:..||.|:.||.:|:|||||...|:| |..||.:|:     |.:...:..::||.
Mouse   313 PWDARLKHHGKLACGGALVSEVVVLTAAHCFIGRQTLEEWSVGLGA-----GPEEWGLKQLILHG 372

  Fly   100 EYDQ-SWSNDIAVMRLQSKLRLGSAVS--VIPLADTPPASGSPATVSGWGAIGFKK----NYPMS 157
            .|.. ....|:|.:.|...:.||..:.  .:|.||.....|.    .|| .:|..:    |||.:
Mouse   373 AYTHPEGGYDVAFLLLAQPVTLGPGLRPLCLPYADHHLPDGE----HGW-VLGLTQKAGINYPQT 432

  Fly   158 ILSASVDIVDQDQCRRSY------GRKITKDMICAAAPGKDA-CSGDSGGPLVSGNK----LVGI 211
            :   .|.::....|.|.:      |..|...|:|....|:.. |.|.||.|||...:    |||:
Mouse   433 V---PVTVLGPMACSRQHAAPGGTGIPILPGMVCTTVVGEPPHCEGLSGAPLVHEIRGTWFLVGL 494

  Fly   212 VSFGKECAHPEYPGVYANVAELKPWI 237
            .|||..|.....|.|:|.::..:.||
Mouse   495 HSFGDTCQSSAKPAVFAALSAYEDWI 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 65/219 (30%)
Tryp_SPc 24..237 CDD:238113 65/219 (30%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46
Tryp_SPc 45..271 CDD:238113
Tryp_SPc 311..522 CDD:238113 67/221 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.