DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and CG9673

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:256 Identity:75/256 - (29%)
Similarity:122/256 - (47%) Gaps:49/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VVSSNWIPE-RIVGGDLITILSVPWQASILRLGRFH-CGAAIYSEDIVITAAHC-----LTDRET 71
            ::|:...|: ||:||:.:.....||.||: |..:.| |..||.|.:.::|||||     :|..:.
  Fly    18 ILSAEASPQGRILGGEDVAQGEYPWSASV-RYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDA 81

  Fly    72 EFLSVRVGSSFTFFGGQVVRVSSVLLHEEYDQSWSNDIAVMRLQSKLRLGSAVSVIPLADTPPA- 135
            ..|:||:|:...:.||.:|.|.||::|..|. ::.:|||::.|...|.....:..|.|   ||. 
  Fly    82 STLAVRLGTINQYAGGSIVNVKSVIIHPSYG-NFLHDIAILELDETLVFSDRIQDIAL---PPTT 142

  Fly   136 ------------SGSPATVSGWGAIG--------FKKNYPMSILSASVDIVDQDQC--RRSYGRK 178
                        :|:|..|:|||.:.        .|.||  :.||.|:       |  ...||  
  Fly   143 DEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANY--NTLSRSL-------CEWEAGYG-- 196

  Fly   179 ITKDMIC-AAAPGKDACSGDSGGPLVSGNKLV-GIVSFGKECAHPEYPGVYANVAELKPWI 237
             .:.::| :.|.|:..|.||:|..::..:|:: |:.||.......:||.|...|:....||
  Fly   197 -YESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 71/244 (29%)
Tryp_SPc 24..237 CDD:238113 70/243 (29%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 71/244 (29%)
Tryp_SPc 29..259 CDD:238113 72/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.