DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and sphe

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:225 Identity:70/225 - (31%)
Similarity:109/225 - (48%) Gaps:15/225 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGDLITILSVPWQASILRLGRFH-CGAAIYSEDIVITAAHC------LTDRETEFLSVRVGS 80
            ||:||:.....:..:.|| ||:...| ||.:|.|:..::|.|||      |.|...  |:.||||
  Fly    25 RIMGGEDADATATTFTAS-LRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASR--LACRVGS 86

  Fly    81 SFTFFGGQVVRVSSVLLHEEYDQSWSNDIAVMRLQSKLRLGSAVSVIPL---ADTPPASGSPATV 142
            :..:.||::|.|.||.:|.:| .:.:|::||:.|.|:|.....::.|||   .:..||.||...|
  Fly    87 TNQYAGGKIVNVESVAVHPDY-YNLNNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIV 150

  Fly   143 SGWGAIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAAAPGKDACSGDSGGPLVSGNK 207
            :|||......| ...|...|:.:..:..|..:|.....:....|....:..|.||.||..:.||.
  Fly   151 AGWGRTSDGTN-SYKIRQISLKVAPEATCLDAYSDHDEQSFCLAHELKEGTCHGDGGGGAIYGNT 214

  Fly   208 LVGIVSFGKECAHPEYPGVYANVAELKPWI 237
            |:|:.:|........||.|:..::....||
  Fly   215 LIGLTNFVVGACGSRYPDVFVRLSSYADWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 68/223 (30%)
Tryp_SPc 24..237 CDD:238113 67/222 (30%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 65/208 (31%)
Tryp_SPc 42..244 CDD:214473 63/206 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.