DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and CG31681

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:236 Identity:98/236 - (41%)
Similarity:131/236 - (55%) Gaps:12/236 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFTFFG 86
            ||||||..|.|..||||.|:.......||..|||:..::||||||::.....||||.|||:...|
  Fly    27 ERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSNVTVTDLSVRAGSSYWSKG 91

  Fly    87 GQVVRVSSVLLHEEYDQSWSN--DIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGAIG 149
            |||::|...:.|.:|.....|  ||||:.|::.||||..|..||||:..|.:|:....||||...
  Fly    92 GQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYTR 156

  Fly   150 FKKNYPMSIL-SASVDIVDQDQCRRSYGR-KITKDMICAAAPGKDACSGDSGGPLVSGNK----- 207
            ...::...|| ...|.|:::..|.::|.. .||.|||||.....|.|.|||||||:...|     
  Fly   157 ENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMICADGQRWDTCQGDSGGPLIETTKGGHRQ 221

  Fly   208 LVGIVSFGKECAHPEYPGVYANVAELKPWILGAIER-ITKS 247
            |:|:||:|..|.  ..||||.::|....||...::: |.||
  Fly   222 LIGMVSWGDGCG--TNPGVYEDIAFFHNWIKYTVKKNIYKS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 92/222 (41%)
Tryp_SPc 24..237 CDD:238113 91/221 (41%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 92/222 (41%)
Tryp_SPc 29..250 CDD:238113 92/222 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443139
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104239at33392
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.