DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and CG31267

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:239 Identity:67/239 - (28%)
Similarity:117/239 - (48%) Gaps:19/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SSNWIPERIVGGDLITILSVPWQASILR-LGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVG 79
            ::|....|||||:...:|:.|:..|:.. .|...|..:|..:..|||||.||.......:.| |.
  Fly    37 TANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQV-VT 100

  Fly    80 SSFTFFG--GQVVRVSSVLLHEEYDQ-SWSNDIAVMRLQSKLRLGSA---VSVIPLADTPPASGS 138
            :::..:|  |.:..|..:::|..:|. .:.||||:::..:.......   :::.||.|.  ..|.
  Fly   101 TTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPLEDL--TDGE 163

  Fly   139 PATVSGWGAIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDM----ICAAAP-GKDACSGDS 198
            ..|:.|:|:.....::...:....|..|..::|..:||.  |.|:    :||... |..||.||:
  Fly   164 TLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNATYGG--TPDLDVGHLCAVGKVGAGACHGDT 226

  Fly   199 GGPLV-SGNKLVGIVSFGKECAHPEYPGVYANVAELKPWILGAI 241
            |||:| |..:|||:.::|..|.: .:|.|:|.::....||:..|
  Fly   227 GGPIVDSRGRLVGVGNWGVPCGY-GFPDVFARISFYYSWIISTI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 63/226 (28%)
Tryp_SPc 24..237 CDD:238113 62/225 (28%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 63/226 (28%)
Tryp_SPc 45..268 CDD:238113 64/228 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.