DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Klk12

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:235 Identity:73/235 - (31%)
Similarity:105/235 - (44%) Gaps:33/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ERIVGGDLITILSVPWQASILRLGRFH-----CGAAIYSEDIVITAAHC-------LTDRETEFL 74
            |:|..|......|.|||     :|.||     ||..:.....|:|||||       |.:.....|
  Rat    20 EKIYNGVECVKNSQPWQ-----VGLFHGKYLRCGGVLVDRKWVLTAAHCSGKYMVRLGEHSLSKL 79

  Fly    75 SVRVGSSFTFFGGQVVRVSSVLLHEEYDQSWSN---DIAVMRLQSKLRLGSAVSVIPLADTPPAS 136
            .:......|.|.         :.|..|..::.|   |:.::||...:.|..||..:.|..:...:
  Rat    80 DLTEQLRLTTFS---------ITHPSYHGAYQNHEHDLRLLRLNRPISLTYAVRPVALPSSCAPT 135

  Fly   137 GSPATVSGWGAIGFKKN-YPMSILSASVDIVDQDQCRRSYGRKITKDMICAAA-PGKDACSGDSG 199
            |:...:||||......: :|..:....:.||..:.||..:..::|::|:||.. .|||||.||||
  Rat   136 GAKCHISGWGTTNKPWDPFPDRLQCLDLSIVSNETCRAVFPGRVTENMLCAGGEAGKDACQGDSG 200

  Fly   200 GPLVSGNKLVGIVSFGK--ECAHPEYPGVYANVAELKPWI 237
            ||||.|..|.|:||:|.  .|.....||||..|.:...||
  Rat   201 GPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 70/232 (30%)
Tryp_SPc 24..237 CDD:238113 70/231 (30%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 70/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.