DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Klk14

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_038956840.1 Gene:Klk14 / 308562 RGDID:1308606 Length:310 Species:Rattus norvegicus


Alignment Length:246 Identity:99/246 - (40%)
Similarity:135/246 - (54%) Gaps:23/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IFLAFSVTVVSSNWIPERIVGGDLITILSVPWQASILRLG---RFHCGAAIYSEDIVITAAHCLT 67
            |..|.:|.:|.|.. .::|:||......|.|||.: |:.|   ||.||..:.|:..|||||||  
  Rat    67 ILQALAVAIVQSQG-DDKILGGYTCVQNSQPWQVA-LQAGPGRRFLCGGVLLSDQWVITAAHC-- 127

  Fly    68 DRETEFLSVRVGS------SFTFFGGQVVRVSSVLLHEEY-DQSWSNDIAVMRLQSKLRLGSAVS 125
              ....|.|.:|.      ..|   .||:||...:.|.:| .|:..||:.:::||.|:|||.||.
  Rat   128 --ARPLLHVALGKHNLRRWEAT---QQVLRVVRQVPHPQYRPQAHDNDLMLLKLQRKVRLGRAVR 187

  Fly   126 VIPLADTPPASGSPATVSGWGAIGFK-KNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAAAP 189
            .||:|.:..:.|:|..|||||..... ..||.::...:|:|:.:..|.|:|...||..|:||..|
  Rat   188 TIPVARSCASPGTPCRVSGWGTTASPIVRYPTALQCVNVNIMPEQVCHRAYPGTITSGMVCAGVP 252

  Fly   190 --GKDACSGDSGGPLVSGNKLVGIVSFGKE-CAHPEYPGVYANVAELKPWI 237
              |||:|.||||||||...:|.|:||:|.| ||.|.|||||.|:.....||
  Rat   253 EGGKDSCQGDSGGPLVCQGQLQGLVSWGMERCAMPGYPGVYTNLCNYHSWI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 92/227 (41%)
Tryp_SPc 24..237 CDD:238113 92/226 (41%)
Klk14XP_038956840.1 Tryp_SPc 84..306 CDD:238113 94/228 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 1 0.900 - - OOG6_128159
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.