DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and GZMA

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_006135.2 Gene:GZMA / 3001 HGNCID:4708 Length:262 Species:Homo sapiens


Alignment Length:266 Identity:77/266 - (28%)
Similarity:130/266 - (48%) Gaps:43/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLAFSVT-VVSSNWIP----ERIVGGDLITILSVPWQASILRLGR-FHCGAAIYSEDIVITAAHC 65
            |||.|:: |||...||    |:|:||:.:|..|.|:.. :|.|.| ..|..|:.::|.|:|||||
Human     7 FLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMV-LLSLDRKTICAGALIAKDWVLTAAHC 70

  Fly    66 LTDRETEFLSVRVGSSFTFFGG----------QVVRVSSVLLHEEYDQSW-SNDIAVMRLQSKLR 119
            ..::.::.:          .|.          |::.|.....:..||.:. ..|:.:::|..|.:
Human    71 NLNKRSQVI----------LGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAK 125

  Fly   120 LGSAVSVIPLA----DTPPASGSPATVSGWGAIGFKKNYPMSILSASVDIVDQDQC--RRSYGRK 178
            :...|:::.|.    |..|  |:...|:|||......::..::...::.|:|:..|  |..|...
Human   126 INKYVTILHLPKKGDDVKP--GTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFN 188

  Fly   179 --ITKDMICAAA--PGKDACSGDSGGPLVSGNKLVGIVSFGKE--CAHPEYPGVYANVAELK-PW 236
              |..:|:||.:  .|:|:|:||||.||:......|:.|||.|  |..|..||||..:::.. .|
Human   189 PVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNW 253

  Fly   237 ILGAIE 242
            |:..|:
Human   254 IIMTIK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 64/238 (27%)
Tryp_SPc 24..237 CDD:238113 64/237 (27%)
GZMANP_006135.2 Tryp_SPc 29..254 CDD:238113 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.