DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Klk10

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:237 Identity:75/237 - (31%)
Similarity:112/237 - (47%) Gaps:22/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSS--FTFFGGQV 89
            |.|...:|.|||.|:....:|.|...:..::.|:|||||..::.   |..|||..  ..|...|:
  Rat    50 GTLCPSVSQPWQVSLFHNLQFQCAGVLVDQNWVLTAAHCWRNKP---LRARVGDDHLLLFQSEQL 111

  Fly    90 VRVSSVLLHEEYD---------QSWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGW 145
            ...:|.:.|.:|.         :|..:|:.:::|.|.:.|.|.|..:.|............||||
  Rat   112 RSTNSPVFHPKYQPCSGPVLPLRSDEHDLMMLKLSSPVVLTSKVHPVQLPFQCAQPRQECQVSGW 176

  Fly   146 GAIGFKK-NYPMSILSASVDIVDQDQCRRSYGRKITKDMICAAAP-GKDACSGDSGGPLVSGNKL 208
            |....:: .|..|:..:.|.::.|.||...|...||.:||||... .:|:|..|||||||..|.|
  Rat   177 GTTANRRVKYNRSLSCSRVTLLSQKQCETFYPGVITNNMICAGMDRDQDSCQSDSGGPLVCDNTL 241

  Fly   209 VGIVSFG-KEC-AHPEYPGVYANVAELKPWILGAIERITKSE 248
            .||:|:. ..| |..:||.|||.:.....|    |.|:.:|:
  Rat   242 HGILSWSIYPCGAATQYPAVYAKICNYTNW----IRRVIRSK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 71/224 (32%)
Tryp_SPc 24..237 CDD:238113 71/224 (32%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.