DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Klk11

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:248 Identity:77/248 - (31%)
Similarity:120/248 - (48%) Gaps:17/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFVQWIFLAFSVTVVSSNWIPERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHC 65
            |.:::|.||.....|...   .||:.|......|.|||.::.:..|..|||.:.:...::|||||
  Rat    31 MILRFIALALVTGHVGGE---TRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHC 92

  Fly    66 LTDRETEFLSVRVGSSFTFFGG--QVVRVSSVLLHEEYDQS-----WSNDIAVMRLQSKLRLGSA 123
               |:..::.:....:.....|  |....:....|..::.|     ..|||.::::.|...:..|
  Rat    93 ---RKPHYVILLGEHNLEKTDGCEQRRMATESFPHPGFNNSLPNKDHRNDIMLVKMSSPAFITRA 154

  Fly   124 VSVIPLADTPPASGSPATVSGWGAIGFKK-NYPMSILSASVDIVDQDQCRRSYGRKITKDMICAA 187
            |..:.|:.....:|:...:||||.....: ..|.|:..|:|.|:...:|.|:|...||..|:||:
  Rat   155 VRPLTLSSLCVTAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIGHKECERAYPGNITDTMLCAS 219

  Fly   188 A--PGKDACSGDSGGPLVSGNKLVGIVSFGKE-CAHPEYPGVYANVAELKPWI 237
            .  .|||:|.||||||||....|.||:|:|:: ||....||||..|.:...||
  Rat   220 VRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYFDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 70/224 (31%)
Tryp_SPc 24..237 CDD:238113 69/223 (31%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 70/224 (31%)
Tryp_SPc 51..275 CDD:238113 71/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.