DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Prss38

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:245 Identity:76/245 - (31%)
Similarity:123/245 - (50%) Gaps:31/245 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGDLITILSVPWQASILRLGRFH-CGAAIYSEDIVITAAHCLT--------DRETEFLSVRV 78
            :::||:|......|||.||...| || ||.:|.:...|:|||||..        |......::.|
  Rat   113 KLLGGELTIDRKWPWQVSIHYAG-FHVCGGSILNAYWVLTAAHCFAREKRLQTFDMYVGITNLEV 176

  Fly    79 GSSFTFFGGQVVRVSSVLLHEEYD--QSWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPAT 141
            .:..|    |...::.|::|..::  .....|:|:  :|||..:..:..|:|:. .|.::.:.:.
  Rat   177 ANKHT----QWFEINQVIIHPTFEMFHPVGGDVAL--VQSKSAIVFSDYVLPIC-LPSSNLNLSD 234

  Fly   142 VS----GWGAIGFKKNYPMSILSASVDIVDQDQCRRSYG--RKITKDMICAA--APGKDACSGDS 198
            :|    |||.:..:......:|.|.:.::.:.||:..||  ..:..:|:||.  ...|:.|.|||
  Rat   235 LSCWTTGWGMVSPQGETGKDLLEAQLPLIPKFQCQLLYGLTSYLLPEMLCAGDIKNMKNVCEGDS 299

  Fly   199 GGPLV-SGNKL---VGIVSFGKECAHPEYPGVYANVAELKPWILGAIERI 244
            |.||| ..|:.   :||||:|:.||.|.||||:|||:....||...:|.|
  Rat   300 GSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLNWIRYNMETI 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 72/236 (31%)
Tryp_SPc 24..237 CDD:238113 72/235 (31%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 73/234 (31%)
Tryp_SPc 116..342 CDD:214473 72/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.