DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and KLK9

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:236 Identity:80/236 - (33%)
Similarity:122/236 - (51%) Gaps:16/236 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WIPERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFT 83
            |...|.:|.:.....|.||||.:..|.|..|||.:.|:..::|||||    ...:|.||:|....
Human    18 WADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLTAAHC----RKPYLWVRLGEHHL 78

  Fly    84 F-FGG--QVVRVSSVLLHEEYDQSWS-----NDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPA 140
            : :.|  |:.||:....|..:::..|     :||.::||..:.||..||..:.|:.|..:.|...
Human    79 WKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSPAVQPLNLSQTCVSPGMQC 143

  Fly   141 TVSGWGAIGFKKN-YPMSILSASVDIVDQDQCRRSYGRKITKDMICAA--APGKDACSGDSGGPL 202
            .:|||||:...|. :|:::..|::.|::...|..:|...|:..|:||.  ..|:.:|.|||||||
Human   144 LISGWGAVSSPKALFPVTLQCANISILENKLCHWAYPGHISDSMLCAGLWEGGRGSCQGDSGGPL 208

  Fly   203 VSGNKLVGIVSFGKE-CAHPEYPGVYANVAELKPWILGAIE 242
            |....|.|:||.|.| |:.|..|.||.:|.....||...:|
Human   209 VCNGTLAGVVSGGAEPCSRPRRPAVYTSVCHYLDWIQEIME 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 76/225 (34%)
Tryp_SPc 24..237 CDD:238113 75/224 (33%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 77/226 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.