DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and KLK13

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_056411.1 Gene:KLK13 / 26085 HGNCID:6361 Length:277 Species:Homo sapiens


Alignment Length:249 Identity:91/249 - (36%)
Similarity:127/249 - (51%) Gaps:23/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SVTVVSSNWIPERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLS 75
            |..|:::|.....:.||......|.||||::|..||..||..:.....|:||||||    .|.|.
Human    23 SSKVLNTNGTSGFLPGGYTCFPHSQPWQAALLVQGRLLCGGVLVHPKWVLTAAHCL----KEGLK 83

  Fly    76 VRVGS---SFTFFGGQVVRVSSVLLHEEYDQS-----WSNDIAVMRLQSKLRLGSAVSVIPLAD- 131
            |.:|.   .....|.||..|...:.|.||.:|     ..:||.::.|||.::|...:..:||:. 
Human    84 VYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLNHDHDIMLLELQSPVQLTGYIQTLPLSHN 148

  Fly   132 ---TPPASGSPATVSGWGAIGFKK-NYPMSILSASVDIVDQDQCRRSYGRKITKDMICAAAP--G 190
               ||   |:...|||||.....: |||.::..|::.:...::||:.|..|||.:|:||...  |
Human   149 NRLTP---GTTCRVSGWGTTTSPQVNYPKTLQCANIQLRSDEECRQVYPGKITDNMLCAGTKEGG 210

  Fly   191 KDACSGDSGGPLVSGNKLVGIVSFGK-ECAHPEYPGVYANVAELKPWILGAIER 243
            ||:|.||||||||....|.||||:|. .|..|:.||||..|:....||...|.:
Human   211 KDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYTRVSRYVLWIRETIRK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 85/229 (37%)
Tryp_SPc 24..237 CDD:238113 85/228 (37%)
KLK13NP_056411.1 Tryp_SPc 38..261 CDD:238113 87/229 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.