DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and KLK5

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:229 Identity:76/229 - (33%)
Similarity:121/229 - (52%) Gaps:13/229 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGDLITILSVPWQAS-ILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVG----SSF 82
            ||:.|....:.:.||||: :||..:.:|||.:.....::|||||   |:..| .||:|    |..
Human    66 RIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHC---RKKVF-RVRLGHYSLSPV 126

  Fly    83 TFFGGQVVRVSSVLLHEEYDQ-SWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWG 146
            ...|.|:.:....:.|..|.. ..|||:.:::|..::|....|..|.::...|::|:...|||||
Human   127 YESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWG 191

  Fly   147 AIGFKK-NYPMSILSASVDIVDQDQCRRSYGRKITKDMICAA-APGKDACSGDSGGPLVSGNKLV 209
            .....: ::|..:...::.::.|.:|..:|.|:|...|.||. ..|:|:|.||||||:|....|.
Human   192 TTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQ 256

  Fly   210 GIVSFGK-ECAHPEYPGVYANVAELKPWILGAIE 242
            |:||:|. .||.|..||||.|:.:...||...|:
Human   257 GLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 73/222 (33%)
Tryp_SPc 24..237 CDD:238113 72/221 (33%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 1/1 (100%)
Tryp_SPc 66..285 CDD:214473 73/222 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.