DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Prss2

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_036861.1 Gene:Prss2 / 25052 RGDID:3418 Length:246 Species:Rattus norvegicus


Alignment Length:247 Identity:84/247 - (34%)
Similarity:128/247 - (51%) Gaps:19/247 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IFLAFSVTVVSSNWIP----ERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCL 66
            :|||.....|:   .|    ::||||......|||:|.| |..|...||.::.::..|::||||.
  Rat     5 LFLALVGAAVA---FPVDDDDKIVGGYTCQENSVPYQVS-LNSGYHFCGGSLINDQWVVSAAHCY 65

  Fly    67 TDRETEFLSVRVGS-SFTFFGG--QVVRVSSVLLHEEYD-QSWSNDIAVMRLQSKLRLGSAVSVI 127
            ..|    :.||:|. :.....|  |.|..:.::.|..:| ::.:|||.:::|.|.::|.:.|:.:
  Rat    66 KSR----IQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATV 126

  Fly   128 PLADTPPASGSPATVSGWG-AIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAA--AP 189
            .|..:...:|:...:|||| .:....|.|..:......::.|..|..||..|||.:|:|..  ..
  Rat   127 ALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEG 191

  Fly   190 GKDACSGDSGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWILGAI 241
            |||:|.||||||:|...:|.||||:|..||.|:.||||..|.....||...|
  Rat   192 GKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 76/220 (35%)
Tryp_SPc 24..237 CDD:238113 76/219 (35%)
Prss2NP_036861.1 Tryp_SPc 23..239 CDD:214473 76/220 (35%)
Tryp_SPc 24..242 CDD:238113 78/222 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.