DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and try-1

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:233 Identity:80/233 - (34%)
Similarity:114/233 - (48%) Gaps:17/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IPERIVGGDLITILSVPWQASIL-RLGRFHCGAAIYSEDIVITAAHCLT-DRETEFLSVRVGSSF 82
            :..|::||...:..|.||...:| |||...||.::...:.|:|||||.. ||.....|||||...
 Worm    54 LDHRLIGGSESSPHSWPWTVQLLSRLGHHRCGGSLIDPNFVLTAAHCFAKDRRPTSYSVRVGGHR 118

  Fly    83 TFFGGQVVRVSSVLLHEEYDQSW--SNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGW 145
            : ..|...||::|.:|..|:..:  |.|.|:||:...:...:....|.|...|........|:||
 Worm   119 S-GSGSPHRVTAVSIHPWYNIGFPSSYDFAIMRIHPPVNTSTTARPICLPSLPAVENRLCVVTGW 182

  Fly   146 GAI--GFKKNYPMSILSASVDIVDQDQCRR--SY-GRKITKDMICAA-APGK-DACSGDSGGPLV 203
            |:.  |...:.| ::....|.::....|..  :| ||.....|:||. :.|| |:|.|||||||:
 Worm   183 GSTIEGSSLSAP-TLREIHVPLLSTLFCSSLPNYIGRIHLPSMLCAGYSYGKIDSCQGDSGGPLM 246

  Fly   204 SGN----KLVGIVSFGKECAHPEYPGVYANVAELKPWI 237
            ...    :|.|:||:|..||.|..||||.||.....||
 Worm   247 CARDGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 78/228 (34%)
Tryp_SPc 24..237 CDD:238113 77/227 (34%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 79/228 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.