DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Mcpt4

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_034909.2 Gene:Mcpt4 / 17227 MGIID:96940 Length:246 Species:Mus musculus


Alignment Length:243 Identity:74/243 - (30%)
Similarity:117/243 - (48%) Gaps:31/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ERIVGGDLITILSVPWQASI----LRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGS-- 80
            |.|:||......|.|:.|.:    .|.....||..:.:...|:||||| :.||   ::|.:|:  
Mouse    19 EEIIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVLTAAHC-SGRE---ITVTLGAHD 79

  Fly    81 -SFTFFGGQVVRVSSVLLHEEYDQSWSN--DIAVMRLQSKLRLGSAVSVIPLADTPPAS-----G 137
             |.|....|.::|...::|.:|: .:||  ||.:::||.|.:...:|:||||   |..|     |
Mouse    80 VSKTESTQQKIKVEKQIVHPKYN-FYSNLHDIMLLKLQKKAKETPSVNVIPL---PRPSDFIKPG 140

  Fly   138 SPATVSGWGAIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAAAPGK--DACSGDSGG 200
            .....:|||..|..:.....:....:.|:|::.| ::|........:|..:|.|  .|..|||||
Mouse   141 KMCRAAGWGRTGVTEPTSDILREVKLRIMDKEAC-KNYWHYDYNLQVCVGSPRKKRSAYKGDSGG 204

  Fly   201 PLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWILGAIERITKSE 248
            ||:......||||:|:..|.|  |.|:..::...||    |.|:.|.:
Mouse   205 PLLCAGVAHGIVSYGRGDAKP--PAVFTRISSYVPW----INRVIKGK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 69/229 (30%)
Tryp_SPc 24..237 CDD:238113 69/228 (30%)
Mcpt4NP_034909.2 Tryp_SPc 20..239 CDD:214473 70/233 (30%)
Tryp_SPc 21..242 CDD:238113 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.