DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Gzmc

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_599159.1 Gene:Gzmc / 171290 RGDID:620019 Length:248 Species:Rattus norvegicus


Alignment Length:245 Identity:71/245 - (28%)
Similarity:102/245 - (41%) Gaps:51/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ERIVGGDLITILSVPWQASILRLG----RFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSF 82
            |.|:||:.::..|.|:.|....|.    :..||..:..::.|:|||||.            |.|.
  Rat    19 EEIIGGNEVSPHSRPYMAYFEFLNDNGKKTFCGGFLVRDNFVLTAAHCR------------GRSM 71

  Fly    83 TFFGG-----------QVVRVSSVLLHEEYD-QSWSNDIAVMRLQSKLRLGSAVSVIPL----AD 131
            |...|           |::.|::...|..|: ...||||.:::|....:..|||..:.|    |.
  Rat    72 TVTLGAHNIKAKEKTQQIIPVANATPHPAYNPDKRSNDIMLLKLVRSAKRTSAVRPLNLPRRNAH 136

  Fly   132 TPPASGSPATVSGWGAIGFKKNYPMSI----LSASVDIVDQDQCRRSYGRKITKDMICAAAPGKD 192
            ..|  |....::|||.|..:..:|.::    |:...|.|.:.|.:|||   |....||.   |..
  Rat   137 VKP--GDVCYMAGWGKITPQGEFPNTLREVELTVQKDRVCESQFQRSY---IKASEICV---GDS 193

  Fly   193 ACSG-----DSGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWI 237
            ...|     |||||||......||||:||  .....|.|:..|.....||
  Rat   194 KTKGASFEEDSGGPLVCKKAAAGIVSYGK--TDGSAPQVFTRVLSFLSWI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 68/242 (28%)
Tryp_SPc 24..237 CDD:238113 68/241 (28%)
GzmcNP_599159.1 Tryp_SPc 20..241 CDD:214473 68/242 (28%)
Tryp_SPc 21..244 CDD:238113 70/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.