DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Klk1b26

DIOPT Version :10

Sequence 1:NP_722784.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_034774.1 Gene:Klk1b26 / 16618 MGIID:891981 Length:261 Species:Mus musculus


Alignment Length:45 Identity:11/45 - (24%)
Similarity:17/45 - (37%) Gaps:5/45 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YYRQNALRSAEFYITLKEPVPQPNKHETKEWYHQTTTREQSEIVL 59
            |||.:......|.||.:...  .|.|   ||..:..:..|...::
Mouse    78 YYRNSVGGLLLFDITNRRSF--QNVH---EWLEEARSHVQPHSIV 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_722784.1 Tryp_SPc 24..237 CDD:238113 8/36 (22%)
Klk1b26NP_034774.1 Tryp_SPc 24..253 CDD:214473 11/45 (24%)

Return to query results.
Submit another query.