DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Prss29

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:254 Identity:85/254 - (33%)
Similarity:133/254 - (52%) Gaps:37/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IVGGDLITILSVPWQASILRLGRFH-------CGAAIYSEDIVITAAHCLTDRETE--FLSVRVG 79
            ||||........|||.| ||:.|::       ||.:|.....|:|||||:.:|:.:  ...:|||
Mouse    31 IVGGHSAPQGKWPWQVS-LRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVG 94

  Fly    80 SSFTFFGGQVVRVSSVLLHEEY-DQSWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPAT-- 141
            .::.:.|.:::.||.|::|.:: .....:|:|:::|...::....|..:.|    |:.....|  
Mouse    95 EAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKL----PSESLEVTKK 155

  Fly   142 ----VSGWGAIGFKKNY--PMSILSASVDIVDQDQCRRSY---------GRK-ITKDMICAAAPG 190
                |:||||:...::.  |..:....|.|:|...|...|         |:| |.|||:||...|
Mouse   156 DVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQG 220

  Fly   191 KDACSGDSGGPL---VSGN-KLVGIVSFGKECAHPEYPGVYANVAELKPWILGAIERIT 245
            :|:|.|||||||   |:|: .|||:||:|..||..::|||||.|....|||...::|.:
Mouse   221 QDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQMQRFS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 82/244 (34%)
Tryp_SPc 24..237 CDD:238113 82/244 (34%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 84/247 (34%)
Tryp_SPc 31..271 CDD:214473 82/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.