DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Prss28

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:259 Identity:79/259 - (30%)
Similarity:123/259 - (47%) Gaps:32/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IFLAFSVTVVSSNWIPERIVGGDLITILSVPWQASILRLGRFH-------CGAAIYSEDIVITAA 63
            :|:| ||::..|.  |..||||........|||.| ||:..:.       ||.:|.....::|||
Mouse    16 VFMA-SVSISRSK--PVGIVGGQCTPPGKWPWQVS-LRMYSYEVNSWVHICGGSIIHPQWILTAA 76

  Fly    64 HCL--TDRETEFLSVRVGSSFTFFGGQVVRVSSVLLHEEY-DQSWSNDIAVMRLQSKLRLGSAVS 125
            ||:  .|.:.....|:||..:.:...:::.:|.:::|.:| |.|...|:|:|:|.:.|...:.||
Mouse    77 HCIQSQDADPAVYRVQVGEVYLYKEQELLNISRIIIHPDYNDVSKRFDLALMQLTALLVTSTNVS 141

  Fly   126 VIPLADTPPA--SGSPATVSGWGAI--GFKKNYPMSILSASVDIVDQDQCRRSYGRK-------- 178
            .:.|......  |.....:.|||.:  ......|..:....:.|.|...|:|:|.:|        
Mouse   142 PVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDNKSCKRAYRKKSSDEHKAV 206

  Fly   179 -ITKDMICAAAPGKDACSGDSGGPLV--SGNK--LVGIVSFGKECAHPEYPGVYANVAELKPWI 237
             |..||:||...|:..|.||||||||  ..||  .||:||.|.:|:: ..|.:::.|.....||
Mouse   207 AIFDDMLCAGTSGRGPCFGDSGGPLVCWKSNKWIQVGVVSKGIDCSN-NLPSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 71/240 (30%)
Tryp_SPc 24..237 CDD:238113 71/239 (30%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 73/241 (30%)
Tryp_SPc 31..269 CDD:214473 71/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.