DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Prss1

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_444473.1 Gene:Prss1 / 114228 MGIID:98839 Length:246 Species:Mus musculus


Alignment Length:247 Identity:83/247 - (33%)
Similarity:129/247 - (52%) Gaps:19/247 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IFLAFSVTVVSSNWIP----ERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCL 66
            :|||.....|:   .|    ::||||......|||:|.| |..|...||.::.::..|::||||.
Mouse     5 LFLALVGAAVA---FPVDDDDKIVGGYTCRENSVPYQVS-LNSGYHFCGGSLINDQWVVSAAHCY 65

  Fly    67 TDRETEFLSVRVGS-SFTFFGG--QVVRVSSVLLHEEYD-QSWSNDIAVMRLQSKLRLGSAVSVI 127
            ..|    :.||:|. :.....|  |.:..:.::.|..:: ::.:|||.:::|.|.:.|.:.|:.:
Mouse    66 KTR----IQVRLGEHNINVLEGNEQFIDAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNARVATV 126

  Fly   128 PLADTPPASGSPATVSGWG-AIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAA--AP 189
            .|..:...:|:...:|||| .:.|..:.|..:......::.|..|..||..|||.:|:||.  ..
Mouse   127 ALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASYPGKITGNMVCAGFLEG 191

  Fly   190 GKDACSGDSGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWILGAI 241
            |||:|.||||||:|...:|.||||:|..||.|:.||||..|.....||...|
Mouse   192 GKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 75/220 (34%)
Tryp_SPc 24..237 CDD:238113 75/219 (34%)
Prss1NP_444473.1 Tryp_SPc 23..239 CDD:214473 75/220 (34%)
Tryp_SPc 24..242 CDD:238113 77/222 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.