DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and KLK11

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:268 Identity:77/268 - (28%)
Similarity:124/268 - (46%) Gaps:36/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VQWIFLAFSVTVVSSNWIPERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLT 67
            :|.|.||.:..:|...   .||:.|......|.||||::....|..|||.:.:...::||||||.
Human    36 LQLILLALATGLVGGE---TRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLK 97

  Fly    68 D----RETEFLSVRVGSS---FTFFGGQVVRVSSVLLHEEY----------------------DQ 103
            .    .....:|..:.||   .:.....:|.:....|.:|.                      ::
Human    98 PWVSLTSPTHVSPDLSSSNYCLSHLSRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNK 162

  Fly   104 SWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGAIGFKK-NYPMSILSASVDIVD 167
            ...|||.::::.|.:.:..||..:.|:.....:|:...:||||:....: ..|.::..|::.|::
Human   163 DHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIE 227

  Fly   168 QDQCRRSYGRKITKDMICAAAP--GKDACSGDSGGPLVSGNKLVGIVSFGKE-CAHPEYPGVYAN 229
            ..:|..:|...||..|:||:..  |||:|.||||||||....|.||:|:|:: ||....||||..
Human   228 HQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTK 292

  Fly   230 VAELKPWI 237
            |.:...||
Human   293 VCKYVDWI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 70/246 (28%)
Tryp_SPc 24..237 CDD:238113 69/245 (28%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 70/246 (28%)
Tryp_SPc 54..303 CDD:238113 71/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6203
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.