Sequence 1: | NP_001259920.1 | Gene: | CG17239 / 59224 | FlyBaseID: | FBgn0042186 | Length: | 248 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011524671.1 | Gene: | KLK11 / 11012 | HGNCID: | 6359 | Length: | 307 | Species: | Homo sapiens |
Alignment Length: | 268 | Identity: | 77/268 - (28%) |
---|---|---|---|
Similarity: | 124/268 - (46%) | Gaps: | 36/268 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 VQWIFLAFSVTVVSSNWIPERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLT 67
Fly 68 D----RETEFLSVRVGSS---FTFFGGQVVRVSSVLLHEEY----------------------DQ 103
Fly 104 SWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGAIGFKK-NYPMSILSASVDIVD 167
Fly 168 QDQCRRSYGRKITKDMICAAAP--GKDACSGDSGGPLVSGNKLVGIVSFGKE-CAHPEYPGVYAN 229
Fly 230 VAELKPWI 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17239 | NP_001259920.1 | Tryp_SPc | 23..237 | CDD:214473 | 70/246 (28%) |
Tryp_SPc | 24..237 | CDD:238113 | 69/245 (28%) | ||
KLK11 | XP_011524671.1 | Tryp_SPc | 53..300 | CDD:214473 | 70/246 (28%) |
Tryp_SPc | 54..303 | CDD:238113 | 71/247 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S6203 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D469244at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | mtm8473 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.870 |