DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and Klk9

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:233 Identity:84/233 - (36%)
Similarity:125/233 - (53%) Gaps:16/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFTF-FG 86
            |.||.......|.||||.:..|.|..|||.:.::..::|||||    ...:|.||:|....: :.
Mouse    22 RAVGARECVRNSQPWQAGLFYLTRQLCGATLINDQWLLTAAHC----RKPYLWVRLGEHHLWRWE 82

  Fly    87 G--QVVRVSSVLLHEEYDQSWS-----NDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSG 144
            |  |::.|:....|..::...|     :||.::||..|:||..||..:.|.::.|..|:...:||
Mouse    83 GPEQLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRKVRLTPAVQPLNLTESRPPVGTQCLISG 147

  Fly   145 WGAIGFKK-NYPMSILSASVDIVDQDQCRRSYGRKITKDMICAA--APGKDACSGDSGGPLVSGN 206
            ||::...| .|||::..|::.|:|...||.:|...|::.|:||.  ..|:.:|.||||||||...
Mouse   148 WGSVSSSKLQYPMTLQCANISILDNKLCRWAYPGHISEKMLCAGLWEGGRGSCQGDSGGPLVCEG 212

  Fly   207 KLVGIVSFGKE-CAHPEYPGVYANVAELKPWILGAIER 243
            .|.||||.|.| |:.|..|.||.||.:...||...:|:
Mouse   213 TLAGIVSGGSEPCSRPRRPAVYTNVFDYLEWIESTMEK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 81/225 (36%)
Tryp_SPc 24..237 CDD:238113 80/224 (36%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 82/226 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6203
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.