DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17239 and LOC100498532

DIOPT Version :9

Sequence 1:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001333498.1 Gene:LOC100498532 / 100498532 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:259 Identity:82/259 - (31%)
Similarity:120/259 - (46%) Gaps:27/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFVQWIFLAFSVTVVSSNWIP-----ERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVI 60
            |...|:.:..:|...:    |     ::||||...|..|.|||......|...||.::.|...:|
 Frog     1 MMPLWVLMFLAVAAAA----PLDDDDDKIVGGYECTPHSQPWQVLFTYNGGNWCGGSLISPRWII 61

  Fly    61 TAAHCLTDRET-------EFLSVRVGSSFTFFGGQVVRVSSVLLHEEY-DQSWSNDIAVMRLQSK 117
            :||||....:|       ..|..:.|:.      |.::|.:...|..| |::..:||.:::|...
 Frog    62 SAAHCYQPPKTLVALLGEHDLKKKEGTE------QHIQVEAAYKHFGYKDKAHDHDIMLVKLAKP 120

  Fly   118 LRLGSAVSVIPLADTPPASGSPATVSGWG-AIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITK 181
            .:....|..||:|.:.|..|:...|||:| .:|:...||..:....|.||....|:.||.|.|::
 Frog   121 AQYNQYVQPIPVARSCPTDGAKCLVSGFGNVLGYNVRYPDQLQCLEVPIVSDSSCKASYPRMISE 185

  Fly   182 DMICAA--APGKDACSGDSGGPLVSGNKLVGIVSF-GKECAHPEYPGVYANVAELKPWILGAIE 242
            :|.||.  ..||.:|.|||||||:...:|.|.||: |..|.....|||||.|.....||....|
 Frog   186 NMFCAGFLEGGKGSCHGDSGGPLICNGELYGAVSWGGSYCISKNSPGVYAKVCNYLDWIKNITE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 75/225 (33%)
Tryp_SPc 24..237 CDD:238113 75/224 (33%)
LOC100498532NP_001333498.1 Tryp_SPc 25..247 CDD:238113 77/227 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.