DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MCU and AT1G57610

DIOPT Version :9

Sequence 1:NP_001246647.1 Gene:MCU / 59223 FlyBaseID:FBgn0042185 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_176074.2 Gene:AT1G57610 / 842137 AraportID:AT1G57610 Length:293 Species:Arabidopsis thaliana


Alignment Length:307 Identity:80/307 - (26%)
Similarity:125/307 - (40%) Gaps:66/307 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 KNRKIKKKLILNRKKKKKKTCNEDIYVEYVNGMPHMTVRLPSRNELCQFALKPISHNVGDLLAML 205
            |....||.:.:...||..:..|       |..|....:.:..:..:....|...|..:|  :|  
plant    38 KEEDEKKDMTVLEAKKLMRLVN-------VEDMKKKLIGMGDKEMVTYTTLIEASQGLG--IA-- 91

  Fly   206 RAEDRGIDRAAVINKHGVRIASSCTIESLLDDSFSIQINNRTLDVNPPKRDKVTLESMDKVGDVR 270
                |.:|.|....:             :|||:..|.|          .||||.|..       .
plant    92 ----RSLDEAHAFAR-------------VLDDAGVILI----------FRDKVYLHP-------H 122

  Fly   271 KVIAQLYEAFNVGEYQLEKSNQLAKELETLRYELEPLEEKKLELSKKAARRTNFMTWMGLGLMSV 335
            ||:..:.:|..:|         |..:.|.:|.|.:.:...|.|:...|.::...:.|.|||...|
plant   123 KVVDLIRKAVPLG---------LNPDDELIREEFDKMRSMKEEIDVLAHQQVRKILWGGLGYSVV 178

  Fly   336 QFGILARLTWWEYSWDIMEPVTYFVTYGTTMAMYAYYCVTKREYMMEDVKNREFSLSLYRNAKKV 400
            |.||..|||:||:|||:|||:|:|.|....:..|||:.:|.|:...:|...|.|.....:..|..
plant   179 QIGIFVRLTFWEFSWDVMEPITFFTTATGIIVGYAYFLMTSRDPTYQDFMKRLFLSRQRKLLKSH 243

  Fly   401 QFDVEHYNELKRK---------SAELEYNLR-RINDPLNMQ--LPSH 435
            :||.|.:.||:.|         |.....::| |:...|:::  |.||
plant   244 KFDAERFKELENKWKITSCSSSSCHANASIRNRVGVDLDLEDSLQSH 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MCUNP_001246647.1 MCU 208..410 CDD:282525 58/201 (29%)
AT1G57610NP_176074.2 MCU 95..253 CDD:398382 57/196 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2778
eggNOG 1 0.900 - - E1_KOG2966
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2436
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076768at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3061
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13462
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1219
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.