DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MCU and AT5G66650

DIOPT Version :9

Sequence 1:NP_001246647.1 Gene:MCU / 59223 FlyBaseID:FBgn0042185 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_201466.1 Gene:AT5G66650 / 836797 AraportID:AT5G66650 Length:321 Species:Arabidopsis thaliana


Alignment Length:232 Identity:65/232 - (28%)
Similarity:96/232 - (41%) Gaps:63/232 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 NNR-TLD--VNPPKRDK--------VTLESMDKV---GDVRKVIAQL---------YEAF--NVG 283
            ||| .||  :.||...|        ||:|.:.|:   .::..|.::|         |..|  ..|
plant    78 NNRIRLDEMLPPPSPKKSSPEFFPAVTVEDVKKLMRAAEMELVKSKLREIGKNWVPYSEFVRVCG 142

  Fly   284 EYQL--EKSNQLAKELE----------------------------TL--------RYELEPLEEK 310
            ||..  |:.|::|..|:                            ||        |.|.|.||..
plant   143 EYSSDPEQGNRVANMLDEAGNVIVLGKLVCLKPEELTSAMAGLIPTLEPSLDAETRQEFEQLEII 207

  Fly   311 KLELSKKAARRTNFMTWMGLGLMSVQFGILARLTWWEYSWDIMEPVTYFVTYGTTMAMYAYYCVT 375
            |.::.|:|........|.||||:..|.....|||:||.|||:|||:.::||....||.||::..|
plant   208 KSDIDKRADDLVRKELWAGLGLIMAQTVGFFRLTFWELSWDVMEPICFYVTSTYFMAGYAFFLRT 272

  Fly   376 KREYMMEDVKNREFSLSLYRNAKKVQFDVEHYNELKR 412
            .:|...|......|.....|..|.:.||::.:.:|::
plant   273 SKEPSFEGFYKSRFETKQKRLIKMLDFDIDRFTKLQK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MCUNP_001246647.1 MCU 208..410 CDD:282525 64/228 (28%)
AT5G66650NP_201466.1 MCU 147..307 CDD:282525 45/159 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2778
eggNOG 1 0.900 - - E1_KOG2966
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2436
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076768at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3061
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13462
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1219
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.