DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MCU and AT5G42610

DIOPT Version :9

Sequence 1:NP_001246647.1 Gene:MCU / 59223 FlyBaseID:FBgn0042185 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_199075.1 Gene:AT5G42610 / 834268 AraportID:AT5G42610 Length:293 Species:Arabidopsis thaliana


Alignment Length:237 Identity:57/237 - (24%)
Similarity:95/237 - (40%) Gaps:65/237 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 SLLDDSFSIQINNRTLDVNPPKRDKVTLESMDKVGDVRKVIAQLYEAFNVGE------------- 284
            :|.|....|:|.:    |:||:|::..:..: .|.:.:|:: :||:...|.|             
plant    48 NLTDRIVGIRIES----VSPPRREETPVMGL-SVSETKKLL-RLYQMEKVKERLREIPKSSVSYW 106

  Fly   285 ----------------YQLEKS------------------NQLAKELETL------------RYE 303
                            .|:.||                  :|:||.:|.:            :.|
plant   107 EFIQICCESCGNDEQGSQMAKSLDHSGCVVVLGDIVFLHPHQIAKSMEAMIKQTSVLPNDPRKEE 171

  Fly   304 LEPLEEKKLELSKKAARRTNFMTWMGLGLMSVQFGILARLTWWEYSWDIMEPVTYFVTYGTTMAM 368
            |..|...|..:..:|.|......:.|||.::||.....|||:||.|||:|||:.:|||....:..
plant   172 LVQLATTKKSIDIEARRIVQAELYCGLGFLAVQTIGFMRLTFWELSWDVMEPICFFVTTIHFILG 236

  Fly   369 YAYYCVTKREYMMEDVKNREFSLSLYRNAKKVQFDVEHYNEL 410
            |.::..|..|...|.:..:.|.....:..::..||...||||
plant   237 YIFFLRTSTEPSFEGLFRQRFKTKQKKLMERHGFDFLRYNEL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MCUNP_001246647.1 MCU 208..410 CDD:282525 55/235 (23%)
AT5G42610NP_199075.1 MCU 119..278 CDD:398382 41/158 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2778
eggNOG 1 0.900 - - E1_KOG2966
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2436
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076768at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3061
orthoMCL 1 0.900 - - OOG6_105346
Panther 1 1.100 - - O PTHR13462
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1219
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.