DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MCU and Mcub

DIOPT Version :9

Sequence 1:NP_001246647.1 Gene:MCU / 59223 FlyBaseID:FBgn0042185 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_080055.2 Gene:Mcub / 66815 MGIID:1914065 Length:345 Species:Mus musculus


Alignment Length:270 Identity:93/270 - (34%)
Similarity:163/270 - (60%) Gaps:0/270 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 EDIYVEYVNGMPHMTVRLPSRNELCQFALKPISHNVGDLLAMLRAEDRGIDRAAVINKHGVRIAS 227
            ::|.|.|.:|:|.:|:.||||.|.|||.:||:...||..|..|:.||:||..||:|...|..|.:
Mouse    67 DEITVTYKHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIITADGSEIPA 131

  Fly   228 SCTIESLLDDSFSIQINNRTLDVNPPKRDKVTLESMDKVGDVRKVIAQLYEAFNVGEYQLEKSNQ 292
            |..:::||...|.:.||....|:...|:::.:.|.|.::.:.:.::.:|:...::.|.|..:...
Mouse   132 STLMDTLLMTDFKLIINKLRYDIRCHKKEEPSGEHMTELENTKSLVHRLFTILHLEEIQKRRERH 196

  Fly   293 LAKELETLRYELEPLEEKKLELSKKAARRTNFMTWMGLGLMSVQFGILARLTWWEYSWDIMEPVT 357
            |..:::.|:.:|.|||:.|..:..::...|:.:.|.||.|:|||.|.||.||||.||||||||||
Mouse   197 LMAKIDHLQEQLRPLEQVKAAIEARSEANTSGLLWAGLALLSVQGGALAWLTWWVYSWDIMEPVT 261

  Fly   358 YFVTYGTTMAMYAYYCVTKREYMMEDVKNREFSLSLYRNAKKVQFDVEHYNELKRKSAELEYNLR 422
            :|:::..::..:||:.:|::.|....:::|:|....::.:::..||||.||:||...||...:|.
Mouse   262 FFLSFANSIVFFAYFIITRQNYTYSSLRSRQFLQFFHKKSQRRCFDVEQYNKLKEDLAEATESLE 326

  Fly   423 RINDPLNMQL 432
            .:...|.:::
Mouse   327 SVRRSLRLRI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MCUNP_001246647.1 MCU 208..410 CDD:282525 67/201 (33%)
McubNP_080055.2 MCU 112..314 CDD:309702 67/201 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2966
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13462
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1219
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.