DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MCU and MCUB

DIOPT Version :9

Sequence 1:NP_001246647.1 Gene:MCU / 59223 FlyBaseID:FBgn0042185 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_060388.2 Gene:MCUB / 55013 HGNCID:26076 Length:336 Species:Homo sapiens


Alignment Length:270 Identity:100/270 - (37%)
Similarity:170/270 - (62%) Gaps:0/270 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 EDIYVEYVNGMPHMTVRLPSRNELCQFALKPISHNVGDLLAMLRAEDRGIDRAAVINKHGVRIAS 227
            ::|.|.|.:|:|.:|:.||||.|.|||.:||:...||..|..|:.||:||..||:....|..|::
Human    58 DEITVIYRHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIFTADGNMISA 122

  Fly   228 SCTIESLLDDSFSIQINNRTLDVNPPKRDKVTLESMDKVGDVRKVIAQLYEAFNVGEYQLEKSNQ 292
            |..::.||.:.|.:.||....||..|||:|.:.|...::..::.::.:|:...::.|.|.::.:.
Human   123 STLMDILLMNDFKLVINKIAYDVQCPKREKPSNEHTAEMEHMKSLVHRLFTILHLEESQKKREHH 187

  Fly   293 LAKELETLRYELEPLEEKKLELSKKAARRTNFMTWMGLGLMSVQFGILARLTWWEYSWDIMEPVT 357
            |.::::.|:.:|:|||:.|..:...:..:|:.:.|.||.|:|:|.|.||.||||.||||||||||
Human   188 LLEKIDHLKEQLQPLEQVKAGIEAHSEAKTSGLLWAGLALLSIQGGALAWLTWWVYSWDIMEPVT 252

  Fly   358 YFVTYGTTMAMYAYYCVTKREYMMEDVKNREFSLSLYRNAKKVQFDVEHYNELKRKSAELEYNLR 422
            ||:|:..:|..:||:.||:::|....||:|:|....::.:|:..|||:.||:||...|:.:.:|:
Human   253 YFITFANSMVFFAYFIVTRQDYTYSAVKSRQFLQFFHKKSKQQHFDVQQYNKLKEDLAKAKESLK 317

  Fly   423 RINDPLNMQL 432
            :....|.:|:
Human   318 QARHSLCLQM 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MCUNP_001246647.1 MCU 208..410 CDD:282525 74/201 (37%)
MCUBNP_060388.2 MCU 102..305 CDD:282525 74/202 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2966
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076768at2759
OrthoFinder 1 1.000 - - FOG0004164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13462
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1219
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.