DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MCU and Mcub

DIOPT Version :9

Sequence 1:NP_001246647.1 Gene:MCU / 59223 FlyBaseID:FBgn0042185 Length:457 Species:Drosophila melanogaster
Sequence 2:XP_006233342.1 Gene:Mcub / 295462 RGDID:1305326 Length:335 Species:Rattus norvegicus


Alignment Length:273 Identity:97/273 - (35%)
Similarity:166/273 - (60%) Gaps:0/273 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 TCNEDIYVEYVNGMPHMTVRLPSRNELCQFALKPISHNVGDLLAMLRAEDRGIDRAAVINKHGVR 224
            |..::|.|.|.:|:|.:|:.||||.|.|||.:||:...||..|..|:.||:||..||::...|..
  Rat    54 TSQDEITVNYRHGLPFVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAMVTADGSE 118

  Fly   225 IASSCTIESLLDDSFSIQINNRTLDVNPPKRDKVTLESMDKVGDVRKVIAQLYEAFNVGEYQLEK 289
            |.::..:::||...|.:.|||...|:...::::.:.|...::.:.:.::.:|:...::.|.|..:
  Rat   119 IPAATLMDTLLMKDFKLVINNLPYDIRRHEKERPSEEHRTQLENTKCLVHRLFTILHLEEVQKRR 183

  Fly   290 SNQLAKELETLRYELEPLEEKKLELSKKAARRTNFMTWMGLGLMSVQFGILARLTWWEYSWDIME 354
            ...|..:::.|:.:|.|||:.|..:..::..:|:.:.|.||.|:|||.|.||.||||.|||||||
  Rat   184 ERHLMAKIDHLQEQLRPLEQVKAGIEARSEAKTSSLLWAGLALLSVQGGALAWLTWWVYSWDIME 248

  Fly   355 PVTYFVTYGTTMAMYAYYCVTKREYMMEDVKNREFSLSLYRNAKKVQFDVEHYNELKRKSAELEY 419
            |||:|:|:..:|..:||:.||::.|..|.:::|:|....:|.:::..||||.||:||...||...
  Rat   249 PVTFFLTFANSMVFFAYFIVTRQNYTYESLRSRQFLQFFHRKSRRQCFDVERYNKLKEDLAEATE 313

  Fly   420 NLRRINDPLNMQL 432
            :|..:...|.::|
  Rat   314 SLENVRHSLCLRL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MCUNP_001246647.1 MCU 208..410 CDD:282525 69/201 (34%)
McubXP_006233342.1 MCU 101..304 CDD:282525 69/202 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2966
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076768at2759
OrthoFinder 1 1.000 - - FOG0004164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13462
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1219
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.