DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MCU and mcub

DIOPT Version :9

Sequence 1:NP_001246647.1 Gene:MCU / 59223 FlyBaseID:FBgn0042185 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001120048.1 Gene:mcub / 100145024 XenbaseID:XB-GENE-5744060 Length:319 Species:Xenopus tropicalis


Alignment Length:281 Identity:120/281 - (42%)
Similarity:181/281 - (64%) Gaps:2/281 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 NEDIYVEYVNGMPHMTVRLPSRNELCQFALKPISHNVGDLLAMLRAEDRGIDRAAVINKHGVRIA 226
            :.|:.|:|.:|:|.:|:.||||||.|||.:||::..:|..|..::.||||||..|..:....:.:
 Frog    40 SSDVTVQYSHGLPVITLTLPSRNERCQFTIKPLTTTLGTFLTDIKKEDRGIDVIAATSTDDTKFS 104

  Fly   227 SSCTIESLLDDSFSIQINNRTLDVNPPKRDKVTLESMDKVGDVRKVIAQLYEAFNVGEYQLEKSN 291
            :|..::.||.:.|.:.|||.|..|.||.|||...:...::..::.::.:||.|.:..||||.|..
 Frog   105 NSTLMDVLLMNDFKLVINNSTYHVQPPSRDKPCPQDSSEMDTIKTLVHRLYAALHQEEYQLNKEQ 169

  Fly   292 QLAKELETLRYELEPLEE-KKLELSKKAARRTNFMTWMGLGLMSVQFGILARLTWWEYSWDIMEP 355
            :|.|.|::|:.:|:|||: |.:.|||..|:.|..| |:||.|||.|.|.||.||||.||||||||
 Frog   170 ELLKRLDSLKEQLQPLEQMKSMILSKSDAKTTRLM-WIGLALMSTQGGALAWLTWWVYSWDIMEP 233

  Fly   356 VTYFVTYGTTMAMYAYYCVTKREYMMEDVKNREFSLSLYRNAKKVQFDVEHYNELKRKSAELEYN 420
            ||||:|||:.:|.|||:.:||::|:...::.|:.....|:.||..:|||..||.|:.:.||.|.:
 Frog   234 VTYFITYGSAIAFYAYFVLTKQDYVYPAIRERQLLNYFYKRAKTQRFDVNEYNRLQEEFAETEES 298

  Fly   421 LRRINDPLNMQLPSHLVRTQE 441
            |||:.:||.:.||...:..:|
 Frog   299 LRRLQNPLRLGLPIEQLNEKE 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MCUNP_001246647.1 MCU 208..410 CDD:282525 89/202 (44%)
mcubNP_001120048.1 MCU 86..288 CDD:282525 89/202 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 217 1.000 Domainoid score I2628
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 285 1.000 Inparanoid score I2789
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076768at2759
OrthoFinder 1 1.000 - - FOG0004164
OrthoInspector 1 1.000 - - otm49001
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1219
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.