DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt305A1 and UGT74B1

DIOPT Version :9

Sequence 1:NP_001261394.1 Gene:Ugt305A1 / 59217 FlyBaseID:FBgn0042179 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_173820.1 Gene:UGT74B1 / 839022 AraportID:AT1G24100 Length:460 Species:Arabidopsis thaliana


Alignment Length:143 Identity:35/143 - (24%)
Similarity:62/143 - (43%) Gaps:24/143 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 FIWNVEQ--LEQLP------AKKPNLLTLHVNQSLQQDILAMQYVKGFLNHGDSFSLQEAIHYGV 381
            |:|.:::  :.:||      .|...||....|   |.::||.:.:..||.|....|..|.:..||
plant   307 FLWVIKEAHIAKLPEGFVESTKDRALLVSWCN---QLEVLAHESIGCFLTHCGWNSTLEGLSLGV 368

  Fly   382 PVVVLPLKLEEFNNAQRVMERNLGVMLQVKEFNQSSLSDALTRILDEERFISALH-----QAQLK 441
            |:|.:|...::.|:|:.|.|        |.:....:..:|...|:..|..:..|.     ::.:|
plant   369 PMVGVPQWSDQMNDAKFVEE--------VWKVGYRAKEEAGEVIVKSEELVRCLKGVMEGESSVK 425

  Fly   442 FRTRPQSALELAV 454
            .|...:...:|||
plant   426 IRESSKKWKDLAV 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt305A1NP_001261394.1 Glycosyltransferase_GTB_type <242..461 CDD:299143 35/143 (24%)
UGT74B1NP_173820.1 Glycosyltransferase_GTB-type 7..455 CDD:415824 35/143 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.