DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt305A1 and UGT85A2

DIOPT Version :9

Sequence 1:NP_001261394.1 Gene:Ugt305A1 / 59217 FlyBaseID:FBgn0042179 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_173653.1 Gene:UGT85A2 / 838843 AraportID:AT1G22360 Length:481 Species:Arabidopsis thaliana


Alignment Length:252 Identity:55/252 - (21%)
Similarity:103/252 - (40%) Gaps:62/252 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 TRP---VLSELMKTENAFPKLQLVLLNT-----HPTLDYVQNLPPGVIEVGGLH-IKNQTSPLPT 281
            |.|   :|:.:::..:...:...::|||     |..:..::::.|.|..:|.|| ::.|.|...:
plant   204 TNPDDIMLNFIIREADRAKRASAIILNTFDDLEHDVIQSMKSIVPPVYSIGPLHLLEKQESGEYS 268

  Fly   282 YI--------QEFTE-------KFFDGIVYINMPYIEYMNDQGLKAMYTMIHGNPNVAFIWNVEQ 331
            .|        :|.||       |..:.:||:|...|            |::.....|.|.|.:..
plant   269 EIGRTGSNLWREETECLDWLNTKARNSVVYVNFGSI------------TVLSAKQLVEFAWGLAA 321

  Fly   332 L--EQLPAKKPNL------------LTLHVNQSL------QQDILAMQYVKGFLNHGDSFSLQEA 376
            .  |.|...:|:|            ||...::.:      |:.:|:...:.|||.|....|..|:
plant   322 TGKEFLWVIRPDLVAGDEAMVPPEFLTATADRRMLASWCPQEKVLSHPAIGGFLTHCGWNSTLES 386

  Fly   377 IHYGVPVVVLPLKLEEFNNAQRVM-ERNLGVML--QVKEFNQSSLSDALTRILDEER 430
            :..|||:|..|...|:..|.:... |..:|:.:  .||   :..:...:..::|||:
plant   387 LCGGVPMVCWPFFAEQQTNCKFSRDEWEVGIEIGGDVK---REEVEAVVRELMDEEK 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt305A1NP_001261394.1 Glycosyltransferase_GTB_type <242..461 CDD:299143 52/233 (22%)
UGT85A2NP_173653.1 Glycosyltransferase_GTB-type 8..475 CDD:385653 55/252 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.