DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt305A1 and UGT75B1

DIOPT Version :9

Sequence 1:NP_001261394.1 Gene:Ugt305A1 / 59217 FlyBaseID:FBgn0042179 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001320882.1 Gene:UGT75B1 / 837058 AraportID:AT1G05560 Length:519 Species:Arabidopsis thaliana


Alignment Length:278 Identity:58/278 - (20%)
Similarity:118/278 - (42%) Gaps:39/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 NAFPKLQLVLLNTHPTLDYVQNLP--PGVIEVGGLH--IKNQTSPLPTYIQEFTEKFFDGIVYIN 298
            |.|..|:...|...|.:|.|...|  |..|..|..:  :|:|:|....::...||   ..::|::
plant   253 NTFDSLEPEALTAFPNIDMVAVGPLLPTEIFSGSTNKSVKDQSSSYTLWLDSKTE---SSVIYVS 314

  Fly   299 M-PYIEYMNDQGLKAMYTMIHGNPNVAFIWNV---------------EQLEQLPAKKPNL--LTL 345
            . ..:|....|..:....:|.|..  .|:|.:               .::|::...:..|  :.:
plant   315 FGTMVELSKKQIEELARALIEGKR--PFLWVITDKSNRETKTEGEEETEIEKIAGFRHELEEVGM 377

  Fly   346 HVNQSLQQDILAMQYVKGFLNHGDSFSLQEAIHYGVPVVVLPLKLEEFNNAQRVMERNLGVMLQV 410
            .|:...|.::|:.:.|..|:.|....|..|::..|||||..|:..::..|| :::|.:....::|
plant   378 IVSWCSQIEVLSHRAVGCFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNA-KLLEESWKTGVRV 441

  Fly   411 KEFNQSSLSD--ALTRILDEERFISALHQAQLKFRTRPQSALELAVWHAEQLIAEPRLFKHFAQT 473
            :| |:..|.:  .:.|.|:     :.:.:..::.|...:....||:....:..:..:..:.|.:.
plant   442 RE-NKDGLVERGEIRRCLE-----AVMEEKSVELRENAKKWKRLAMEAGREGGSSDKNMEAFVED 500

  Fly   474 ---ETLAQNFFVANSLDV 488
               |:|.||...|..:.|
plant   501 ICGESLIQNLCEAEEVKV 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt305A1NP_001261394.1 Glycosyltransferase_GTB_type <242..461 CDD:299143 49/242 (20%)
UGT75B1NP_001320882.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.