DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt305A1 and AT5G37950

DIOPT Version :9

Sequence 1:NP_001261394.1 Gene:Ugt305A1 / 59217 FlyBaseID:FBgn0042179 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:427 Identity:83/427 - (19%)
Similarity:150/427 - (35%) Gaps:128/427 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LGRFCSLEAANILCLVSTAKHNNPGWSKPLFDALLANGHSLLVISTAPNPEPKKQVD--GLVYY- 74
            |||..||:..:|....:...:.||  ||.|.|         ....|.|...|...:.  |.::: 
plant     4 LGRAHSLKGFSITVAQTKFNYLNP--SKDLAD---------FQFITIPESLPASDLKTLGPIWFI 57

  Fly    75 -HLPNEYDVMKR----HFLLEEPREYISMVTLNQLLVWYE----------VLLG-------SCRA 117
             .|..|.::..:    .|||:: :|.|:.|..::.:.:.|          |:..       :||:
plant    58 IKLNKECEISFKKCLGQFLLQQ-QEEIACVIYDEFMYFAEAAAKEFNLPKVIFSTENATAFACRS 121

  Fly   118 ----LLNSDTMS------SKRPELTAQL-SMEYDLIITDVTQGIECLMDSVSGWRSKPVLGLSAG 171
                |...|.::      .:..||..:| .:.|..:.|.....:|.   ||..::|      |..
plant   122 AMCKLYAKDGIAPLTEGCGREEELVPELHPLRYKDLPTSAFAPVEA---SVEVFKS------SCE 177

  Fly   172 KLTPDLMSLLRAENTINAARIPHYISQVPKTMGFWNRLHNHIMYYAEPLIHLVITRPVLSELMKT 236
            |.|...|.:    ||::...    ||.:.     |.:....|..|....:::|.:.|..|.|.:.
plant   178 KGTASSMII----NTVSCLE----ISSLE-----WLQQELKIPIYPIGPLYMVSSAPPTSLLDEN 229

  Fly   237 ENAFPKLQLVLLNTHPTLDYVQNLPPGVIEVGGLHIKNQTSPLPTYIQEFTEKFFDGIVYINMPY 301
            |:.              :|::....|                             ..::||::..
plant   230 ESC--------------IDWLNKQKP-----------------------------SSVIYISLGS 251

  Fly   302 IEYMNDQGLKAMYTMIHG--NPNVAFIWNVEQLEQLPAKKPN--LLTLH--------VNQSLQQD 354
            ...:.   .|.:..|..|  :.|..|:|.:.....|.::..|  |.::.        |..:.|:.
plant   252 FTLLE---TKEVLEMASGLVSSNQYFLWAIRPGSILGSELSNEELFSMMEIPDRGYIVKWATQKQ 313

  Fly   355 ILAMQYVKGFLNHGDSFSLQEAIHYGVPVVVLPLKLE 391
            :||...|..|.:|....|..|:|..|:|:|.|.|.::
plant   314 VLAHAAVGAFWSHCGWNSTLESIGEGIPIVGLLLLIK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt305A1NP_001261394.1 Glycosyltransferase_GTB_type <242..461 CDD:299143 28/162 (17%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 80/418 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.