DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt305A1 and AT5G05900

DIOPT Version :9

Sequence 1:NP_001261394.1 Gene:Ugt305A1 / 59217 FlyBaseID:FBgn0042179 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_196209.1 Gene:AT5G05900 / 830475 AraportID:AT5G05900 Length:450 Species:Arabidopsis thaliana


Alignment Length:430 Identity:88/430 - (20%)
Similarity:145/430 - (33%) Gaps:132/430 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LLANGHSLLVISTAPNPEPKKQVDGLVYYHLPNEYDVMKRHFLLEEPREYISMVTLNQLLVWYEV 110
            |.:.|.|:.||.|..|...........:..:|:.         |.|.......:||         
plant    30 LHSRGFSITVIHTRFNAPKASNHPLFTFLQIPDG---------LSETETRTHDITL--------- 76

  Fly   111 LLGSCRALLNSDTMSSKRPELTAQLSMEYDLIITDVTQGIECLMDSVSGW-RSKPVLGLSAGKLT 174
            ||    .|||....|..|..|| :|....|....:..|.|.||:|. ||| .::||         
plant    77 LL----TLLNRSCESPFRECLT-KLLQSADSETGEEKQRISCLIDD-SGWIFTQPV--------- 126

  Fly   175 PDLMSLLRAENTINAARIPHYISQVPKTMGFWNRLHNHIMYYAEPLIHLVITRPVLSELMKTENA 239
                        ..:..:|..:....|           :.::.:..:...:.|.:...|..:|..
plant   127 ------------AQSFNLPRLVLNTYK-----------VSFFRDHFVLPQLRREMYLPLQDSEQG 168

  Fly   240 ------FPKLQ-----LVLLNTHPTLDYVQNL-------PPGVIEVGGLHIKNQTS--------P 278
                  ||.|:     .:|......||...|:       ..|:|.|......:|.|        .
plant   169 DDPVEEFPPLRKKDLLQILDQESEQLDSYSNMILETTKASSGLIFVSTCEELDQDSLSQAREDYQ 233

  Fly   279 LPTYIQEFTEKFFDG----IVYINMPYIEYMNDQGLKAMYTMIHG------------------NP 321
            :|.:....:..:|.|    :..::...|.:::.|..|::..:..|                  |.
plant   234 VPIFTIGPSHSYFPGSSSSLFTVDETCIPWLDKQEDKSVIYVSFGSISTIGEAEFMEIAWALRNS 298

  Fly   322 NVAFIWNV---------EQLEQLPAKKPNLLTLHVNQSLQQDILAMQYVKGFLNHGDSFSLQEAI 377
            :..|:|.|         |.:|||..|..     .||.:.||::|..|.:.|||.|....|..|::
plant   299 DQPFLWVVRGGSVVHGAEWIEQLHEKGK-----IVNWAPQQEVLKHQAIGGFLTHNGWNSTVESV 358

  Fly   378 HYGVPVVVLPLKLEEFNNAQRV-------------MERNL 404
            ..|||::.:|...::..||:.|             :|||:
plant   359 FEGVPMICMPFVWDQLLNARFVSDVWMVGLHLEGRIERNV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt305A1NP_001261394.1 Glycosyltransferase_GTB_type <242..461 CDD:299143 48/227 (21%)
AT5G05900NP_196209.1 Glycosyltransferase_GTB_type 2..447 CDD:299143 88/430 (20%)
YjiC 8..436 CDD:224732 88/430 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.