DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt305A1 and AT3G46680

DIOPT Version :9

Sequence 1:NP_001261394.1 Gene:Ugt305A1 / 59217 FlyBaseID:FBgn0042179 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_190252.1 Gene:AT3G46680 / 823821 AraportID:AT3G46680 Length:449 Species:Arabidopsis thaliana


Alignment Length:215 Identity:54/215 - (25%)
Similarity:92/215 - (42%) Gaps:40/215 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 VLLNTHPTLD--------YVQNLPPGVIEVGGLHIKNQTSPLPTYIQE-------FTEKFFDGIV 295
            |::||...|:        :...:|  |..:|.|||  ..|...:.::|       ..::....:|
plant   208 VIINTVRCLESSSLKRLQHELGIP--VYALGPLHI--TVSAASSLLEEDRSCVEWLNKQKPRSVV 268

  Fly   296 YINMPYIEYMNDQGLKAMYTMIHG--NPNVAFIWNV--------EQLEQLPAKKPNLLTLH---V 347
            ||::..:..|.   .|.:..|..|  |.|..|:|.:        |.:|.||.:...:::..   |
plant   269 YISLGSVVQME---TKEVLEMARGLFNSNQPFLWVIRPGSIAGSEWIESLPEEVIKMVSERGYIV 330

  Fly   348 NQSLQQDILAMQYVKGFLNHGDSFSLQEAIHYGVPVVVLPLKLEEFNNAQRVMER--NLGVMLQV 410
            ..:.|.::|....|.||.:|....|..|:|..|||::..|...|:..|| ..:|.  .:|..:|.
plant   331 KWAPQIEVLGHPAVGGFWSHCGWNSTLESIVEGVPMICRPFHGEQKLNA-LCLESIWRIGFQVQG 394

  Fly   411 KEFNQSSLSDALTR-ILDEE 429
            | ..:..:..|:.| |:|||
plant   395 K-VERGGVERAVKRLIVDEE 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt305A1NP_001261394.1 Glycosyltransferase_GTB_type <242..461 CDD:299143 54/215 (25%)
AT3G46680NP_190252.1 Glycosyltransferase_GTB_type 1..449 CDD:299143 54/215 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.