DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt305A1 and UGT76E11

DIOPT Version :9

Sequence 1:NP_001261394.1 Gene:Ugt305A1 / 59217 FlyBaseID:FBgn0042179 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_190251.1 Gene:UGT76E11 / 823820 AraportID:AT3G46670 Length:451 Species:Arabidopsis thaliana


Alignment Length:220 Identity:48/220 - (21%)
Similarity:92/220 - (41%) Gaps:51/220 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 VLLNTHPTLD------YVQNLPPGVIEVGGLHIKNQTSPLPTYIQEFTEKFFDGIVYINMPYIEY 304
            |::||...|:      ..|.|...|..:|.||:....|  .:.::|            |...||:
plant   207 VIINTASCLESSSLSRLQQQLQIPVYPIGPLHLVASAS--TSLLEE------------NKSCIEW 257

  Fly   305 MNDQGLKAMYTMIHG------------------NPNVAFIWNV--------EQLEQLPAKKPNLL 343
            :|.|...::..:..|                  :....|:|.:        |.:|.||.:...::
plant   258 LNKQKKNSVIFVSLGSLALMEINEVIETALGLDSSKQQFLWVIRPGSVRGSEWIENLPKEFSKII 322

  Fly   344 T---LHVNQSLQQDILAMQYVKGFLNHGDSFSLQEAIHYGVPVVVLPLKLEEFNNAQRVMERNLG 405
            :   ..|..:.|:::|:...|.||.:|....|..|:|..|||::..|...::..|| |.:|....
plant   323 SGRGYIVKWAPQKEVLSHPAVGGFWSHCGWNSTLESIGEGVPMICKPFSSDQMVNA-RYLECVWK 386

  Fly   406 VMLQVK-EFNQSSLSDALTRILDEE 429
            :.:||: :.::.::..|:.|::.||
plant   387 IGIQVEGDLDRGAVERAVRRLMVEE 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt305A1NP_001261394.1 Glycosyltransferase_GTB_type <242..461 CDD:299143 48/220 (22%)
UGT76E11NP_190251.1 PLN02410 1..451 CDD:178032 48/220 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.