DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt305A1 and UGT71B6

DIOPT Version :9

Sequence 1:NP_001261394.1 Gene:Ugt305A1 / 59217 FlyBaseID:FBgn0042179 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_188815.2 Gene:UGT71B6 / 821732 AraportID:AT3G21780 Length:479 Species:Arabidopsis thaliana


Alignment Length:420 Identity:85/420 - (20%)
Similarity:155/420 - (36%) Gaps:133/420 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 TMSSKR----PELTAQLSMEYDLIITDVTQGIECLMDSVSGWRSKPVLGLSAGKLT----PDLMS 179
            :.|||.    ..||:...:.|::|.....|..|...........||::..:..||.    ||...
plant    41 SFSSKNTSMITSLTSNNRLRYEIISGGDQQPTELKATDSHIQSLKPLVRDAVAKLVDSTLPDAPR 105

  Fly   180 L------LRAENTINAAR---IPHYISQVPKTMGFWN-RLHNHIMYYAEPL----------IHLV 224
            |      :...:.|:.|.   :|.|:... ...||.. .||...||.||.:          :.||
plant   106 LAGFVVDMYCTSMIDVANEFGVPSYLFYT-SNAGFLGLLLHIQFMYDAEDIYDMSELEDSDVELV 169

  Fly   225 I---TRP----VLSELMKTE----------NAFPKLQLVLLNTHPTLD-----YVQN------LP 261
            :   |.|    .|..:.|::          ..|.:.:.:|:||.|.|:     ::.|      .|
plant   170 VPSLTSPYPLKCLPYIFKSKEWLTFFVTQARRFRETKGILVNTVPDLEPQALTFLSNGNIPRAYP 234

  Fly   262 PGVIEVGGLHIKNQTSPLPTYIQEFTEKFFDGIVYINMPYIE--------YMNDQGLKAMYTMIH 318
            .|.:    ||:||                      :|..|::        ::::|..:::..:..
plant   235 VGPL----LHLKN----------------------VNCDYVDKKQSEILRWLDEQPPRSVVFLCF 273

  Fly   319 GN------------------PNVAFIWNVEQ-----LEQLPAKKPNLLTL--------------H 346
            |:                  ....|:|::.:     |.:.|.:..||..:              .
plant   274 GSMGGFSEEQVRETALALDRSGHRFLWSLRRASPNILREPPGEFTNLEEILPEGFFDRTANRGKV 338

  Fly   347 VNQSLQQDILAMQYVKGFLNHGDSFSLQEAIHYGVPVVVLPLKLEEFNNAQRVMERNLGVMLQVK 411
            :..:.|..|||...:.||::||...|..|::.:|||:.:.||..|:..||..::| .||:.:::|
plant   339 IGWAEQVAILAKPAIGGFVSHGGWNSTLESLWFGVPMAIWPLYAEQKFNAFEMVE-ELGLAVEIK 402

  Fly   412 EFNQSSL----SDALTRILDEERFISALHQ 437
            :..:..|    |:.:|....|:..|..:.|
plant   403 KHWRGDLLLGRSEIVTAEEIEKGIICLMEQ 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt305A1NP_001261394.1 Glycosyltransferase_GTB_type <242..461 CDD:299143 50/256 (20%)
UGT71B6NP_188815.2 PLN02554 1..473 CDD:215304 85/420 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.