DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt305A1 and AT2G36970

DIOPT Version :9

Sequence 1:NP_001261394.1 Gene:Ugt305A1 / 59217 FlyBaseID:FBgn0042179 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_181234.1 Gene:AT2G36970 / 818271 AraportID:AT2G36970 Length:490 Species:Arabidopsis thaliana


Alignment Length:447 Identity:79/447 - (17%)
Similarity:171/447 - (38%) Gaps:109/447 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VSTAKHNNPGWSKPLFDALLANGHSLLVISTAPNPEP---------KKQVDGLVYYHLPNEYDVM 83
            :|||..::.|   .:|.|..::|...:..:|..:..|         .:..:|:::....:..|::
plant    51 ISTAHQDDAG---DIFSAARSSGQHDIRYTTVSDGFPLDFDRSLNHDQFFEGILHVFSAHVDDLI 112

  Fly    84 KRHFLLEEPREYISMVTLNQLLVWYEVLLGSCRALLNSDTMSSKRPELTAQLSMEYDLIITD--- 145
            .:....::|.  ::.:..:...||..::... ..|:|....:  .|.|...|....||:|::   
plant   113 AKLSRRDDPP--VTCLIADTFYVWSSMICDK-HNLVNVSFWT--EPALVLNLYYHMDLLISNGHF 172

  Fly   146 -VTQGIECLMDSVSGWRSKPVLGLSAGKLTP-DLMSLLR-AENTINAARIPHYISQVPKTMGFWN 207
             .....:.::|.|.|.::          :.| ||||.|: ::..::.                  
plant   173 KSLDNRKDVIDYVPGVKA----------IEPKDLMSYLQVSDKDVDT------------------ 209

  Fly   208 RLHNHIMYYAEPLIHLVITRPVLSELMKTENAFPKLQLVLLNTHPTLDYVQNLPPG--------- 263
               |.::|..               |.|......:...|:.||      ||.|.|.         
plant   210 ---NTVVYRI---------------LFKAFKDVKRADFVVCNT------VQELEPDSLSALQAKQ 250

  Fly   264 -VIEVGGLHIKNQTSPLPTYIQEFTEKFFDG-----IVYINMPYIEYMNDQGLKAMYTMIHG--N 320
             |..:|.:...:...|...:.:....::..|     ::|::.....::   |.|.:..:.||  .
plant   251 PVYAIGPVFSTDSVVPTSLWAESDCTEWLKGRPTGSVLYVSFGSYAHV---GKKEIVEIAHGLLL 312

  Fly   321 PNVAFIWNVEQLEQLPAKKPNLLT-----------LHVNQSLQQDILAMQYVKGFLNHGDSFSLQ 374
            ..::||| |.:.:.:.:..|:.|.           |.|....|.::::...|.||..|....|:.
plant   313 SGISFIW-VLRPDIVGSNVPDFLPAGFVDQAQDRGLVVQWCCQMEVISNPAVGGFFTHCGWNSIL 376

  Fly   375 EAIHYGVPVVVLPLKLEEFNNAQRVMER-NLGVML-QVKEFNQSSLSDALTRILDEE 429
            |::..|:|::..||..::|.|.:.|::. .:|:.| :.|...:..:|..:.|:::.|
plant   377 ESVWCGLPLLCYPLLTDQFTNRKLVVDDWCIGINLCEKKTITRDQVSANVKRLMNGE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt305A1NP_001261394.1 Glycosyltransferase_GTB_type <242..461 CDD:299143 44/218 (20%)
AT2G36970NP_181234.1 Glycosyltransferase_GTB_type 1..470 CDD:299143 79/447 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.