DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt305A1 and AT2G31790

DIOPT Version :9

Sequence 1:NP_001261394.1 Gene:Ugt305A1 / 59217 FlyBaseID:FBgn0042179 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_180738.1 Gene:AT2G31790 / 817736 AraportID:AT2G31790 Length:457 Species:Arabidopsis thaliana


Alignment Length:247 Identity:53/247 - (21%)
Similarity:105/247 - (42%) Gaps:47/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 PLIHLVITRPVLSELMKTE----NAFPKL----------QLVLLNTHPTL--DYVQNLPPGVIEV 267
            ||:|..:.|. .|.|::.:    |.|.:|          |..:.|..|.:  .::.|..|   |.
plant   186 PLLHEFVVRQ-FSNLLQADCILCNTFDQLEPKVVKWMNDQWPVKNIGPVVPSKFLDNRLP---ED 246

  Fly   268 GGLHIKN-QTSPLPTYIQEFTEKFFDGIVYINMPYIEYMNDQGLKAMYTMIHGNPNVAFIWNVEQ 331
            ....::| :|.|..:.::....:....:||:....:..::::.:|.: .|........|:|:|.:
plant   247 KDYELENSKTEPDESVLKWLGNRPAKSVVYVAFGTLVALSEKQMKEI-AMAISQTGYHFLWSVRE 310

  Fly   332 LE--QLPA--------KKPNLLTLHVNQSLQQDILAMQYVKGFLNHGDSFSLQEAIHYGVPVVVL 386
            .|  :||:        |...|:...|.   |.::||.:.:..|::|....|..||:..|||:|.:
plant   311 SERSKLPSGFIEEAEEKDSGLVAKWVP---QLEVLAHESIGCFVSHCGWNSTLEALCLGVPMVGV 372

  Fly   387 PLKLEEFNNAQRVME--------RNLGVMLQVKEFNQSSLSDALTRILDEER 430
            |...::..||:.:.:        |..|..|..||    .::..:..:::.||
plant   373 PQWTDQPTNAKFIEDVWKIGVRVRTDGEGLSSKE----EIARCIVEVMEGER 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt305A1NP_001261394.1 Glycosyltransferase_GTB_type <242..461 CDD:299143 45/220 (20%)
AT2G31790NP_180738.1 Glycosyltransferase_GTB_type 3..454 CDD:299143 53/247 (21%)
YjiC 6..454 CDD:224732 53/247 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.