DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt305A1 and UGT73B5

DIOPT Version :9

Sequence 1:NP_001261394.1 Gene:Ugt305A1 / 59217 FlyBaseID:FBgn0042179 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001189528.1 Gene:UGT73B5 / 816040 AraportID:AT2G15480 Length:494 Species:Arabidopsis thaliana


Alignment Length:171 Identity:36/171 - (21%)
Similarity:71/171 - (41%) Gaps:46/171 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 IVYINM-PYIEYMNDQGLKAMYTMIHGNPNVAFIWNVEQLEQ----------------------L 335
            :||::. ....:.|||.|:..:. :.|: ..:|||.|.:.|.                      :
plant   290 VVYLSFGSGTNFTNDQLLEIAFG-LEGS-GQSFIWVVRKNENQGDNEEWLPEGFKERTTGKGLII 352

  Fly   336 PAKKPNLLTLHVNQSLQQDILAMQYVKGFLNHGDSFSLQEAIHYGVPVVVLPLKLEEFNNAQRVM 400
            |...|.:|           ||..:.:.||:.|....|..|.|..|:|:|..|:..|:|.| ::::
plant   353 PGWAPQVL-----------ILDHKAIGGFVTHCGWNSAIEGIAAGLPMVTWPMGAEQFYN-EKLL 405

  Fly   401 ER------NLGVMLQVKE---FNQSSLSDALTRILDEERFI 432
            .:      |:|....||:   .:::.:..|:..::..|:.:
plant   406 TKVLRIGVNVGATELVKKGKLISRAQVEKAVREVIGGEKAV 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt305A1NP_001261394.1 Glycosyltransferase_GTB_type <242..461 CDD:299143 36/171 (21%)
UGT73B5NP_001189528.1 PLN03007 4..494 CDD:178584 36/171 (21%)
MGT 14..456 CDD:273616 36/171 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.