DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt305A1 and Ugt307A1

DIOPT Version :9

Sequence 1:NP_001261394.1 Gene:Ugt305A1 / 59217 FlyBaseID:FBgn0042179 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_609097.2 Gene:Ugt307A1 / 33993 FlyBaseID:FBgn0031887 Length:502 Species:Drosophila melanogaster


Alignment Length:563 Identity:114/563 - (20%)
Similarity:210/563 - (37%) Gaps:165/563 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLGRFCSLEAANILCLVSTAKHNNPGWSKPLFDALLANGHSLLVISTAPNPEPKKQVDGLV-YYH 75
            :||.|.::..:.::..::..:            |||..||.|.:::|.|..|  :::.|.| :.:
  Fly    33 ILGLFVNVHRSQLMVHLAVCR------------ALLQRGHHLTLVTTLPLEE--QEIQGNVSHIY 83

  Fly    76 LPNEYDVMKRHFLLEEPREYISMVTLNQLLVWYEVLLGSCRALLNSDTMSSKRPE----LTAQLS 136
            :|           .::|:|.:|.   :.|::..|.:.   |.|.:|..:.. .||    |..|.:
  Fly    84 IP-----------WQQPKEEVSS---SDLILRLERMF---RRLEHSGDLLD-LPEWKMFLRNQPN 130

  Fly   137 MEYDLII-----TDVTQGIECLMDSVSGWRSKPVLGLSAGKLTPDLMSLLRAENTINAARIPH-Y 195
            ..|||::     .|...|:....:.       ||..:|..:.|..:.||:  .|......:|. |
  Fly   131 TPYDLLLLGYHFNDHLLGVAAHFNC-------PVAIVSTQQPTGFVNSLM--GNPEERWYVPQPY 186

  Fly   196 ISQVPK-----TMGFWNRLHNHIMYYAEPLIHLVITRPVLSELMKTENAFPKLQ-------LVLL 248
            ..|...     ..|.|.:       :.|.|...|:.|  :..|...|..:|..:       |.|.
  Fly   187 DGQQRSGISAWVFGMWEK-------FMEILARRVLAR--IYRLHFPEPQYPSFETMRRSVVLALS 242

  Fly   249 NTHPTLD-YVQNLPPGVIEVGGLHIKNQTSPLP--------------------------TYIQEF 286
            |.|...: .:..|.|.::::||:.::.|....|                          ..::.|
  Fly   243 NHHMISEGPIAPLIPSMVDIGGIVLEQQLDKTPLEISAGNRSLIIFSLGTRFTWRKSTKELVRTF 307

  Fly   287 TEKF-----------FDG----IVYINMPYIEYMNDQGLKAMYTMIHGNPNVAFIWNVEQLEQLP 336
            |:.|           :||    .:.::.|:::                   ||..|...|:.|  
  Fly   308 TKAFAQFPDYDIYWTYDGPNGSAISLDYPHLK-------------------VAKWWPQTQMWQ-- 351

  Fly   337 AKKPNLLTLHVNQSLQQDILAMQYVKGFLNHGDSFSLQEAIHYGVPVVVLPLKLEEFNNAQRVME 401
                                 ...|:.|:.||...|:.||:.||||::.|||..::.:|.||:..
  Fly   352 ---------------------SGKVRLFITHGGKGSVSEALFYGVPMLGLPLIGDQRDNLQRMQS 395

  Fly   402 RNLGVMLQVKEFNQSSLSDALTRILDEERFISALHQAQLKFRTRPQSALELAVWHAEQLIAEPRL 466
            :|.|:.|.........|:.|:||:|.:..:...:.:|...:|.||.|..:|..:..|.::..   
  Fly   396 KNWGLTLSTNNLTHWKLAKAITRMLSDSSYGETILKASQLYRDRPVSPSDLVTYWIEYIVRH--- 457

  Fly   467 FKHFAQTETLAQ--NFFVANSLDV--LTVPLIVLLAAVVSLAN 505
             |........|:  |....:|:||  :...|::|..|::...|
  Fly   458 -KGAKNLHNPARQLNIIEYHSIDVYFIVYGLLILTIAILRKVN 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt305A1NP_001261394.1 Glycosyltransferase_GTB_type <242..461 CDD:299143 53/267 (20%)
Ugt307A1NP_609097.2 egt 13..492 CDD:223071 112/554 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445826
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D53444at6656
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48043
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.