DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt305A1 and Y43D4A.2

DIOPT Version :9

Sequence 1:NP_001261394.1 Gene:Ugt305A1 / 59217 FlyBaseID:FBgn0042179 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_502984.3 Gene:Y43D4A.2 / 189851 WormBaseID:WBGene00012788 Length:151 Species:Caenorhabditis elegans


Alignment Length:113 Identity:25/113 - (22%)
Similarity:37/113 - (32%) Gaps:23/113 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 VLLGSCRALLNSDTMSSKRPELTAQLSME-YDLIITD-VTQGIECLMDSVSGWRSKPVLGLSAGK 172
            :....||.:|..       .||..:|..| :||.||: .......|.:::.......||..|   
 Worm    18 IFASQCRKVLED-------KELIERLRAENFDLAITEPFDTCANALFEAIKIRAHVAVLSCS--- 72

  Fly   173 LTPDLMSLLRAENTINAARIPHYISQVPKTMG----FWNRLHNHIMYY 216
                  .|......|.....|.|:.....|.|    .|.|..| |:::
 Worm    73 ------RLDHVSKAIGQPIAPSYLPGTQSTHGERMTIWQRFMN-ILHF 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt305A1NP_001261394.1 Glycosyltransferase_GTB_type <242..461 CDD:299143
Y43D4A.2NP_502984.3 UDPGT 14..>120 CDD:278624 25/113 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.