DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt305A1 and ugt-1

DIOPT Version :9

Sequence 1:NP_001261394.1 Gene:Ugt305A1 / 59217 FlyBaseID:FBgn0042179 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_505671.1 Gene:ugt-1 / 179449 WormBaseID:WBGene00007072 Length:529 Species:Caenorhabditis elegans


Alignment Length:283 Identity:67/283 - (23%)
Similarity:105/283 - (37%) Gaps:89/283 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 TYIQ--EFTEKFFDGIVYINMPYIEYMNDQGLKAMYTMIHGNPNVAFIWNVE-QLEQLPAKKPNL 342
            |.||  :..|.|.|||:                   .|.|..|:..|||..| :.:|...:.|| 
 Worm   306 TVIQSADMPESFKDGII-------------------KMFHLLPDTTFIWKYEVEDQQFIERLPN- 350

  Fly   343 LTLHVNQSL-----QQDILAMQYVKGFLNHGDSFSLQEAIHYGVPVVVLPLKLEEFNNAQRVMER 402
                 |..|     |..:||...:|.|:.||...|..|..:.|.|.:::|:..::..|| :::.|
 Worm   351 -----NAILKKWVPQPALLADPRLKLFVTHGGLGSTLEVAYSGKPALMIPVFGDQLLNA-KMLSR 409

  Fly   403 NLGVMLQVKEFNQSSLSD------ALTRILDEERFISALHQAQLKFRTRPQSALELAVWHAEQLI 461
            :.|..:    |::..|.|      |:..|:..|.|....|......|.:|               
 Worm   410 HGGATV----FDKYDLEDAEKLTSAIKEIIGNEEFNKKSHHIADLLRNQP--------------- 455

  Fly   462 AEPR--LFKH------FAQTETLA-----QNFFVANSLDVLTVPLIVLLAAVVSLANLVYVLYTG 513
            .:|:  |.||      |.:.:.|.     .||.....||...: :..:|..:..||:|::     
 Worm   456 IDPKANLLKHVEFSAKFGRVDALEPYNVHYNFVQYYMLDAFAI-IFSILIIIFYLAHLLF----- 514

  Fly   514 GSKRQQTLEKAVLKK--RKKSKK 534
                     |.|.|.  :.||||
 Worm   515 ---------KFVYKHVFKTKSKK 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt305A1NP_001261394.1 Glycosyltransferase_GTB_type <242..461 CDD:299143 46/193 (24%)
ugt-1NP_505671.1 UDPGT 28..528 CDD:278624 65/281 (23%)
egt <190..494 CDD:223071 54/232 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.